Lineage for d1yema_ (1yem A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864463Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 864464Superfamily d.63.1: CYTH-like phosphatases [55154] (2 families) (S)
  5. 864474Family d.63.1.2: CYTH domain [118007] (4 proteins)
    Pfam PF01928
  6. 864479Protein Hypothetical protein PF0863 [118008] (1 species)
  7. 864480Species Pyrococcus furiosus [TaxId:2261] [118009] (1 PDB entry)
    Uniprot Q8U2H2 2-171
  8. 864481Domain d1yema_: 1yem A: [116646]
    Structural genomics target

Details for d1yema_

PDB Entry: 1yem (more details), 2.3 Å

PDB Description: conserved hypothetical protein pfu-838710-001 from pyrococcus furiosus
PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d1yema_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yema_ d.63.1.2 (A:) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]}
seveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfk
eildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegi
gdfvdievisdspeeakekiwevakmlglkeedveprlyleli

SCOP Domain Coordinates for d1yema_:

Click to download the PDB-style file with coordinates for d1yema_.
(The format of our PDB-style files is described here.)

Timeline for d1yema_: