Lineage for d1ye3a2 (1ye3 A:164-339)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574153Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 574171Protein Alcohol dehydrogenase [51737] (9 species)
  7. 574199Species Horse (Equus caballus) [TaxId:9796] [51738] (34 PDB entries)
  8. 574208Domain d1ye3a2: 1ye3 A:164-339 [116645]
    Other proteins in same PDB: d1ye3a1
    complexed with mpd, zn

Details for d1ye3a2

PDB Entry: 1ye3 (more details), 1.59 Å

PDB Description: horse liver alcohol dehydrogenase apoenzyme

SCOP Domain Sequences for d1ye3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ye3a2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus)}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

SCOP Domain Coordinates for d1ye3a2:

Click to download the PDB-style file with coordinates for d1ye3a2.
(The format of our PDB-style files is described here.)

Timeline for d1ye3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ye3a1