Lineage for d1ye2d_ (1ye2 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1977385Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 1977509Species Human (Homo sapiens) [TaxId:9606] [46501] (233 PDB entries)
    Uniprot P68871
  8. 1977617Domain d1ye2d_: 1ye2 D: [116643]
    Other proteins in same PDB: d1ye2a_, d1ye2c_
    complexed with hem, oxy

Details for d1ye2d_

PDB Entry: 1ye2 (more details), 1.8 Å

PDB Description: T-To-T(High) quaternary transitions in human hemoglobin: betaY35F oxy (2MM IHP, 20% PEG) (1 test set)
PDB Compounds: (D:) hemoglobin beta chain

SCOPe Domain Sequences for d1ye2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ye2d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvfpwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1ye2d_:

Click to download the PDB-style file with coordinates for d1ye2d_.
(The format of our PDB-style files is described here.)

Timeline for d1ye2d_: