Lineage for d1ydzc_ (1ydz C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 631855Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 631932Species Human (Homo sapiens) [TaxId:9606] [46487] (178 PDB entries)
  8. 632266Domain d1ydzc_: 1ydz C: [116630]
    Other proteins in same PDB: d1ydzb_, d1ydzd_
    complexed with hem, o2; mutant

Details for d1ydzc_

PDB Entry: 1ydz (more details), 3.3 Å

PDB Description: t-to-t(high) quaternary transitions in human hemoglobin: alphay140f oxy (2mm ihp, 20% peg) (1 test set)
PDB Compounds: (C:) hemoglobin alpha chain

SCOP Domain Sequences for d1ydzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydzc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskfr

SCOP Domain Coordinates for d1ydzc_:

Click to download the PDB-style file with coordinates for d1ydzc_.
(The format of our PDB-style files is described here.)

Timeline for d1ydzc_: