Lineage for d1ydzc_ (1ydz C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2299703Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2299831Species Human (Homo sapiens) [TaxId:9606] [46487] (254 PDB entries)
    Uniprot P69905 P01922 P01934 P01935
  8. 2300232Domain d1ydzc_: 1ydz C: [116630]
    Other proteins in same PDB: d1ydzb_, d1ydzd_
    complexed with hem, oxy

Details for d1ydzc_

PDB Entry: 1ydz (more details), 3.3 Å

PDB Description: T-To-T(High) quaternary transitions in human hemoglobin: alphaY140F oxy (2MM IHP, 20% PEG) (1 test set)
PDB Compounds: (C:) hemoglobin alpha chain

SCOPe Domain Sequences for d1ydzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydzc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskfr

SCOPe Domain Coordinates for d1ydzc_:

Click to download the PDB-style file with coordinates for d1ydzc_.
(The format of our PDB-style files is described here.)

Timeline for d1ydzc_: