Lineage for d1ydza_ (1ydz A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716076Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1716199Species Human (Homo sapiens) [TaxId:9606] [46487] (232 PDB entries)
    Uniprot P69905 P01922 P01934 P01935
  8. 1716592Domain d1ydza_: 1ydz A: [116628]
    Other proteins in same PDB: d1ydzb_, d1ydzd_
    complexed with hem, oxy

Details for d1ydza_

PDB Entry: 1ydz (more details), 3.3 Å

PDB Description: t-to-t(high) quaternary transitions in human hemoglobin: alphay140f oxy (2mm ihp, 20% peg) (1 test set)
PDB Compounds: (A:) hemoglobin alpha chain

SCOPe Domain Sequences for d1ydza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydza_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskfr

SCOPe Domain Coordinates for d1ydza_:

Click to download the PDB-style file with coordinates for d1ydza_.
(The format of our PDB-style files is described here.)

Timeline for d1ydza_: