![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins) has many additional secondary structures |
![]() | Protein Probable oxidoreductase At4g09670 [118039] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118040] (2 PDB entries) Uniprot Q9SZ83 |
![]() | Domain d1ydwb2: 1ydw B:134-304 [116627] Other proteins in same PDB: d1ydwa1, d1ydwb1 Structural genomics target |
PDB Entry: 1ydw (more details), 2.49 Å
SCOPe Domain Sequences for d1ydwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ydwb2 d.81.1.5 (B:134-304) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} nprtallkeflsdserfgqlktvqscfsfagdedflkndirvkpgldglgalgdagwyai ratllannfelpktvtafpgavlneagvilscgaslswedgrtatiycsflanltmeita igtkgtlrvhdfiipyketeasfttstkawfndlvtawvsppsehtvktel
Timeline for d1ydwb2: