Lineage for d1ydwb1 (1ydw B:6-133,B:305-360)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2844118Protein Probable oxidoreductase At4g09670 [117429] (1 species)
  7. 2844119Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117430] (2 PDB entries)
    Uniprot Q9SZ83
  8. 2844123Domain d1ydwb1: 1ydw B:6-133,B:305-360 [116626]
    Other proteins in same PDB: d1ydwa2, d1ydwb2
    Structural genomics target

Details for d1ydwb1

PDB Entry: 1ydw (more details), 2.49 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at4g09670
PDB Compounds: (B:) AX110P-like protein

SCOPe Domain Sequences for d1ydwb1:

Sequence, based on SEQRES records: (download)

>d1ydwb1 c.2.1.3 (B:6-133,B:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
mdgtmwvhXpqeacmvrefarlvgeiknngakpdgywpsisrktqlvvdavkesvdknyq
qisls

Sequence, based on observed residues (ATOM records): (download)

>d1ydwb1 c.2.1.3 (B:6-133,B:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
mdgtmwvhXpqeacmvrefaiknngakpdgywpsisrktqlvvdavkesvdknyqqisls

SCOPe Domain Coordinates for d1ydwb1:

Click to download the PDB-style file with coordinates for d1ydwb1.
(The format of our PDB-style files is described here.)

Timeline for d1ydwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ydwb2