Lineage for d1ydwa2 (1ydw A:134-304)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1916230Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 1916303Protein Probable oxidoreductase At4g09670 [118039] (1 species)
  7. 1916304Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118040] (2 PDB entries)
    Uniprot Q9SZ83
  8. 1916305Domain d1ydwa2: 1ydw A:134-304 [116625]
    Other proteins in same PDB: d1ydwa1, d1ydwb1
    Structural genomics target

Details for d1ydwa2

PDB Entry: 1ydw (more details), 2.49 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at4g09670
PDB Compounds: (A:) AX110P-like protein

SCOPe Domain Sequences for d1ydwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydwa2 d.81.1.5 (A:134-304) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nprtallkeflsdserfgqlktvqscfsfagdedflkndirvkpgldglgalgdagwyai
ratllannfelpktvtafpgavlneagvilscgaslswedgrtatiycsflanltmeita
igtkgtlrvhdfiipyketeasfttstkawfndlvtawvsppsehtvktel

SCOPe Domain Coordinates for d1ydwa2:

Click to download the PDB-style file with coordinates for d1ydwa2.
(The format of our PDB-style files is described here.)

Timeline for d1ydwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ydwa1