SCOPe 2.08: Domain d1ydwa2: 1ydw A:134-304

Lineage for d1ydwa2 (1ydw A:134-304)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
   has many additional secondary structures

6. Protein Probable oxidoreductase At4g09670 [118039] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118040] (2 PDB entries)
   Uniprot Q9SZ83

8. Domain d1ydwa2: 1ydw A:134-304 [116625]
   Other proteins in same PDB: d1ydwa1, d1ydwb1
   Structural genomics target

Details for d1ydwa2

PDB Entry: 1ydw, 2.49 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at4g09670

PDB Compounds: (A:) AX110P-like protein

SCOPe Domain Sequences for d1ydwa2:

Sequence; same for both SEQRES and ATOM records:

>d1ydwa2 d.81.1.5 (A:134-304) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nprtallkeflsdserfgqlktvqscfsfagdedflkndirvkpgldglgalgdagwyai
ratllannfelpktvtafpgavlneagvilscgaslswedgrtatiycsflanltmeita
igtkgtlrvhdfiipyketeasfttstkawfndlvtawvsppsehtvktel

Timeline for d1ydwa2:

• d1ydwa2 first appeared in SCOP 1.71
  
• d1ydwa2 appears in SCOPe 2.07