Lineage for d1ydwa1 (1ydw A:6-133,A:305-360)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 820760Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 821277Protein Probable oxidoreductase At4g09670 [117429] (1 species)
  7. 821278Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117430] (1 PDB entry)
    Uniprot Q9SZ83
  8. 821279Domain d1ydwa1: 1ydw A:6-133,A:305-360 [116624]
    Other proteins in same PDB: d1ydwa2, d1ydwb2
    Structural genomics target

Details for d1ydwa1

PDB Entry: 1ydw (more details), 2.49 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at4g09670
PDB Compounds: (A:) AX110P-like protein

SCOP Domain Sequences for d1ydwa1:

Sequence, based on SEQRES records: (download)

>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
mdgtmwvhXpqeacmvrefarlvgeiknngakpdgywpsisrktqlvvdavkesvdknyq
qisls

Sequence, based on observed residues (ATOM records): (download)

>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
mdgtmwvhXpqeacmvrefarlvywpsisrktqlvvdavkesvdknyqqisls

SCOP Domain Coordinates for d1ydwa1:

Click to download the PDB-style file with coordinates for d1ydwa1.
(The format of our PDB-style files is described here.)

Timeline for d1ydwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ydwa2