Lineage for d1ydhb_ (1ydh B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922906Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2922907Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) (S)
  5. 2922908Family c.129.1.1: MoCo carrier protein-like [102406] (7 proteins)
    Pfam PF03641
  6. 2922915Protein Hypothetical protein At5g11950 [117567] (1 species)
  7. 2922916Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117568] (2 PDB entries)
    Uniprot Q84MC2
  8. 2922920Domain d1ydhb_: 1ydh B: [116623]
    Structural genomics target
    complexed with edo, no3

Details for d1ydhb_

PDB Entry: 1ydh (more details), 2.15 Å

PDB Description: x-ray structure of a lysine decarboxylase-like protein from arabidopsis thaliana gene at5g11950
PDB Compounds: (B:) At5g11950

SCOPe Domain Sequences for d1ydhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydhb_ c.129.1.1 (B:) Hypothetical protein At5g11950 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rfrkicvfcgshsghrevfsdaaielgnelvkrkidlvygggsvglmglisrrvyegglh
vlgiipkalmpieisgetvgdvrvvadmherkaamaqeaeafialpggygtmeellemit
wsqlgihkktvgllnvdgyynnllalfdtgveegfikpgarnivvsaptakelmekmeey
t

SCOPe Domain Coordinates for d1ydhb_:

Click to download the PDB-style file with coordinates for d1ydhb_.
(The format of our PDB-style files is described here.)

Timeline for d1ydhb_: