Lineage for d1ydha_ (1ydh A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595507Fold c.129: Putative lysine decarboxylase [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 595508Superfamily c.129.1: Putative lysine decarboxylase [102405] (1 family) (S)
  5. 595509Family c.129.1.1: Putative lysine decarboxylase [102406] (5 proteins)
    Pfam 03641
  6. 595510Protein Hypothetical protein At5g11950 [117567] (1 species)
  7. 595511Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117568] (1 PDB entry)
  8. 595512Domain d1ydha_: 1ydh A: [116622]

Details for d1ydha_

PDB Entry: 1ydh (more details), 2.15 Å

PDB Description: x-ray structure of a lysine decarboxylase-like protein from arabidopsis thaliana gene at5g11950

SCOP Domain Sequences for d1ydha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydha_ c.129.1.1 (A:) Hypothetical protein At5g11950 {Thale cress (Arabidopsis thaliana)}
qrsrfrkicvfcgshsghrevfsdaaielgnelvkrkidlvygggsvglmglisrrvyeg
glhvlgiipkalmpieisgetvgdvrvvadmherkaamaqeaeafialpggygtmeelle
mitwsqlgihkktvgllnvdgyynnllalfdtgveegfikpgarnivvsaptakelmekm
eeyt

SCOP Domain Coordinates for d1ydha_:

Click to download the PDB-style file with coordinates for d1ydha_.
(The format of our PDB-style files is described here.)

Timeline for d1ydha_: