SCOPe 2.08: Domain d1ydha_: 1ydh A:

Lineage for d1ydha_ (1ydh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567

4. Superfamily c.129.1: MCP/YpsA-like [102405] (6 families)

5. Family c.129.1.1: MoCo carrier protein-like [102406] (7 proteins)
   Pfam PF03641

6. Protein Hypothetical protein At5g11950 [117567] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117568] (2 PDB entries)
   Uniprot Q84MC2

8. Domain d1ydha_: 1ydh A: [116622]
   Structural genomics target
   complexed with edo, no3

Details for d1ydha_

PDB Entry: 1ydh, 2.15 Å

PDB Description: x-ray structure of a lysine decarboxylase-like protein from arabidopsis thaliana gene at5g11950

PDB Compounds: (A:) At5g11950

SCOPe Domain Sequences for d1ydha_:

Sequence; same for both SEQRES and ATOM records:

>d1ydha_ c.129.1.1 (A:) Hypothetical protein At5g11950 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qrsrfrkicvfcgshsghrevfsdaaielgnelvkrkidlvygggsvglmglisrrvyeg
glhvlgiipkalmpieisgetvgdvrvvadmherkaamaqeaeafialpggygtmeelle
mitwsqlgihkktvgllnvdgyynnllalfdtgveegfikpgarnivvsaptakelmekm
eeyt

Timeline for d1ydha_:

• d1ydha_ first appeared in SCOP 1.71
  
• d1ydha_ appears in SCOPe 2.07