Lineage for d1ydgg_ (1ydg G:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825904Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 826166Family c.23.5.8: WrbA-like [117474] (2 proteins)
  6. 826175Protein Trp repressor binding protein WrbA [117475] (2 species)
  7. 826176Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries)
    Uniprot Q9RYU4
  8. 826183Domain d1ydgg_: 1ydg G: [116620]
    Structural genomics target

Details for d1ydgg_

PDB Entry: 1ydg (more details), 2 Å

PDB Description: crystal structure of trp repressor binding protein wrba
PDB Compounds: (G:) Trp repressor binding protein WrbA

SCOP Domain Sequences for d1ydgg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydgg_ c.23.5.8 (G:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]}
tapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanie
amkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamts
aqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendr
asirhqvrrqveltaklleggs

SCOP Domain Coordinates for d1ydgg_:

Click to download the PDB-style file with coordinates for d1ydgg_.
(The format of our PDB-style files is described here.)

Timeline for d1ydgg_: