Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (8 families) |
Family c.23.5.8: WrbA-like [117474] (1 protein) |
Protein Trp repressor binding protein WrbA [117475] (1 species) |
Species Deinococcus radiodurans [TaxId:1299] [117476] (1 PDB entry) |
Domain d1ydgg_: 1ydg G: [116620] |
PDB Entry: 1ydg (more details), 2 Å
SCOP Domain Sequences for d1ydgg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ydgg_ c.23.5.8 (G:) Trp repressor binding protein WrbA {Deinococcus radiodurans} tapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanie amkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamts aqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendr asirhqvrrqveltaklleggs
Timeline for d1ydgg_: