SCOPe 2.08: Domain d1ydgg1: 1ydg G:2-201

Lineage for d1ydgg1 (1ydg G:2-201)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.8: WrbA-like [117474] (3 proteins)

6. Protein Trp repressor binding protein WrbA [117475] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries)
   Uniprot Q9RYU4

8. Domain d1ydgg1: 1ydg G:2-201 [116620]
   Other proteins in same PDB: d1ydga2, d1ydgb2, d1ydgc2, d1ydgd2, d1ydge2, d1ydge3, d1ydgf2, d1ydgg2, d1ydgh2
   Structural genomics target
   complexed with so4

Details for d1ydgg1

PDB Entry: 1ydg, 2 Å

PDB Description: crystal structure of trp repressor binding protein wrba

PDB Compounds: (G:) Trp repressor binding protein WrbA

SCOPe Domain Sequences for d1ydgg1:

Sequence; same for both SEQRES and ATOM records:

>d1ydgg1 c.23.5.8 (G:2-201) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]}
tapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanie
amkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamts
aqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendr
asirhqvrrqveltaklleg

Timeline for d1ydgg1:

• d1ydgg1 first appeared in SCOP 1.71, called d1ydgg_
  
• d1ydgg1 appears in SCOPe 2.07