Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1ydge_ (1ydg E:)

  1. Root: SCOP 1.75B
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. Family c.23.5.8: WrbA-like [117474] (3 protein domains)
  6. Protein Trp repressor binding protein WrbA [117475] (3 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries)
    Uniprot Q9RYU4
  8. Domain d1ydge_: 1ydg E: [116618]
    Structural genomics target
    complexed with so4

Details for d1ydge_

PDB Entry: 1ydg (more details)
PDB Description: crystal structure of trp repressor binding protein wrba
PDB Compounds: (E:) Trp repressor binding protein WrbA

SCOP Domain Sequences for d1ydge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydge_ c.23.5.8 (E:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]}
sltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkan
ieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsam
tsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllen
drasirhqvrrqveltaklleggs

SCOP Domain Coordinates for d1ydge_:

Click to download the PDB-style file with coordinates for d1ydge_.
(The format of our PDB-style files is described here.)

Timeline for d1ydge_:

d1ydge_ appears in SCOP 1.75A


d1ydge_
(click for larger image)


d1ydge_ in context of chain



d1ydge_ in context of PDB
Domains from other chains:
d1ydga_, d1ydgb_, d1ydgc_, d1ydgd_, d1ydgf_, d1ydgg_, d1ydgh_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu