Lineage for d1ydgc_ (1ydg C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 578848Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 579039Family c.23.5.8: WrbA-like [117474] (1 protein)
  6. 579040Protein Trp repressor binding protein WrbA [117475] (1 species)
  7. 579041Species Deinococcus radiodurans [TaxId:1299] [117476] (1 PDB entry)
  8. 579044Domain d1ydgc_: 1ydg C: [116616]

Details for d1ydgc_

PDB Entry: 1ydg (more details), 2 Å

PDB Description: crystal structure of trp repressor binding protein wrba

SCOP Domain Sequences for d1ydgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydgc_ c.23.5.8 (C:) Trp repressor binding protein WrbA {Deinococcus radiodurans}
tapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanie
amkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamts
aqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendr
asirhqvrrqveltaklleggs

SCOP Domain Coordinates for d1ydgc_:

Click to download the PDB-style file with coordinates for d1ydgc_.
(The format of our PDB-style files is described here.)

Timeline for d1ydgc_: