Lineage for d1ycnb_ (1ycn B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539977Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 539978Superfamily a.65.1: Annexin [47874] (1 family) (S)
    duplication: consists of four domains of the same fold
  5. 539979Family a.65.1.1: Annexin [47875] (9 proteins)
  6. 540059Protein Plant annexin-like protein [47892] (2 species)
  7. 540063Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116946] (1 PDB entry)
  8. 540065Domain d1ycnb_: 1ycn B: [116613]
    Structural genomics target

Details for d1ycnb_

PDB Entry: 1ycn (more details), 2.51 Å

PDB Description: x-ray structure of annexin from arabidopsis thaliana gene at1g35720

SCOP Domain Sequences for d1ycnb_:

Sequence, based on SEQRES records: (download)

>d1ycnb_ a.65.1.1 (B:) Plant annexin-like protein {Thale cress (Arabidopsis thaliana)}
satlkvsdsvpapsddaeqlrtafegwgtnedliisilahrsaeqrkvirqayhetyged
llktldkelsndferaillwtlepgerdallaneatkrwtssnqvlmevactrtstqllh
arqayharykksleedvahhttgdfrkllvslvtsyryegdevnmtlakqeaklvhekik
dkhyndedvirilstrskaqinatfnryqddhgeeilksleegddddkflallrstiqcl
trpelyfvdvlrsainktgtdegaltrivttraeidlkvigeeyqrrnsiplekaitkdt
rgdyekmlvallgedda

Sequence, based on observed residues (ATOM records): (download)

>d1ycnb_ a.65.1.1 (B:) Plant annexin-like protein {Thale cress (Arabidopsis thaliana)}
satlkvsdsvpapsddaeqlrtaedliisilahrsaeqrkvirqayhetygedllktlds
ndferaillwtlepgerdallaneatkrwtssnqvlmevactrtstqllharqayharyk
ksleedvahhttgdfrkllvslvtsyryegdevnmtlakqeaklvhekikdkhyndedvi
rilstrskaqinatfnryqddhgeeilksleegddddkflallrstiqcltrpelyfvdv
lrsainktgtdegaltrivttraeidlkvigeeyqrrnsiplekaitkdtrgdyekmlva
llgedda

SCOP Domain Coordinates for d1ycnb_:

Click to download the PDB-style file with coordinates for d1ycnb_.
(The format of our PDB-style files is described here.)

Timeline for d1ycnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ycna_