Lineage for d1ycna_ (1ycn A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1738953Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 1738954Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 1738955Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 1739045Protein Plant annexin-like protein [47892] (2 species)
  7. 1739049Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116946] (2 PDB entries)
    Uniprot Q9SYT0
  8. 1739052Domain d1ycna_: 1ycn A: [116612]
    Structural genomics target

Details for d1ycna_

PDB Entry: 1ycn (more details), 2.51 Å

PDB Description: x-ray structure of annexin from arabidopsis thaliana gene at1g35720
PDB Compounds: (A:) putative Ca2+-dependent membrane-binding protein annexin

SCOPe Domain Sequences for d1ycna_:

Sequence, based on SEQRES records: (download)

>d1ycna_ a.65.1.1 (A:) Plant annexin-like protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
satlkvsdsvpapsddaeqlrtafegwgtnedliisilahrsaeqrkvirqayhetyged
llktldkelsndferaillwtlepgerdallaneatkrwtssnqvlmevactrtstqllh
arqayharykksleedvahhttgdfrkllvslvtsyryegdevnmtlakqeaklvhekik
dkhyndedvirilstrskaqinatfnryqddhgeeilksleegddddkflallrstiqcl
trpelyfvdvlrsainktgtdegaltrivttraeidlkvigeeyqrrnsiplekaitkdt
rgdyekmlvallgedda

Sequence, based on observed residues (ATOM records): (download)

>d1ycna_ a.65.1.1 (A:) Plant annexin-like protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
satlkvsdsvpapsddaeqlrtafeedliisilahrsaeqrkvirqayhetygedllktl
dkelsndferaillwtlepgerdallaneatkrwtssnqvlmevactrtstqllharqay
harykksleedvahhttgdfrkllvslvtsyryegdevnmtlakqeaklvhekikdkhyn
dedvirilstrskaqinatfnryqddhgeeilksleegddddkflallrstiqcltrpel
yfvdvlrsainktgtdegaltrivttraeidlkvigeeyqrrnsiplekaitkdtrgdye
kmlvallgedda

SCOPe Domain Coordinates for d1ycna_:

Click to download the PDB-style file with coordinates for d1ycna_.
(The format of our PDB-style files is described here.)

Timeline for d1ycna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ycnb_