Lineage for d1ybfc_ (1ybf C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2140830Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2140916Protein AMP nucleosidase [110645] (2 species)
    contains extra N-terminal oligomerisation (sub)domain (8-153)
  7. 2140917Species Bacteroides thetaiotaomicron [TaxId:818] [117658] (1 PDB entry)
    Uniprot Q7MVU1
  8. 2140920Domain d1ybfc_: 1ybf C: [116611]
    Structural genomics target

Details for d1ybfc_

PDB Entry: 1ybf (more details), 2.9 Å

PDB Description: crystal structure of amp nucleosidase from bacteroides thetaiotaomicron vpi-5482
PDB Compounds: (C:) AMP nucleosidase

SCOPe Domain Sequences for d1ybfc_:

Sequence, based on SEQRES records: (download)

>d1ybfc_ c.56.2.1 (C:) AMP nucleosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
ktkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnasaeg
vtlinfgmgsanaatimdllwaihpkaviflgkcgglklenalgdyllpiaairgegtsn
dylpeevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsthasg
vdmetatlmtvgfankipmgalllisdrpmfpegvkteesdqlvtdnfaeehlmlgidal
eiirenk

Sequence, based on observed residues (ATOM records): (download)

>d1ybfc_ c.56.2.1 (C:) AMP nucleosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
ktkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnasaeg
vtlinfgmgsanaatimdllwaihpkaviflgkcgglalgdyllpiaairgegtsndylp
eevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsthasgvdme
tatlmtvgfankipmgalllisdrpmfpenfaeehlmlgidaleiirenk

SCOPe Domain Coordinates for d1ybfc_:

Click to download the PDB-style file with coordinates for d1ybfc_.
(The format of our PDB-style files is described here.)

Timeline for d1ybfc_: