SCOPe 2.08: Domain d1ybfc_: 1ybf C:

Lineage for d1ybfc_ (1ybf C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein AMP nucleosidase [110645] (2 species)
   contains extra N-terminal oligomerisation (sub)domain (8-153)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [117658] (1 PDB entry)
   Uniprot Q7MVU1

8. Domain d1ybfc_: 1ybf C: [116611]
   Structural genomics target

Details for d1ybfc_

PDB Entry: 1ybf, 2.9 Å

PDB Description: crystal structure of amp nucleosidase from bacteroides thetaiotaomicron vpi-5482

PDB Compounds: (C:) AMP nucleosidase

SCOPe Domain Sequences for d1ybfc_:

Sequence, based on SEQRES records:

>d1ybfc_ c.56.2.1 (C:) AMP nucleosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
ktkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnasaeg
vtlinfgmgsanaatimdllwaihpkaviflgkcgglklenalgdyllpiaairgegtsn
dylpeevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsthasg
vdmetatlmtvgfankipmgalllisdrpmfpegvkteesdqlvtdnfaeehlmlgidal
eiirenk

Sequence, based on observed residues (ATOM records):

>d1ybfc_ c.56.2.1 (C:) AMP nucleosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
ktkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnasaeg
vtlinfgmgsanaatimdllwaihpkaviflgkcgglalgdyllpiaairgegtsndylp
eevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsthasgvdme
tatlmtvgfankipmgalllisdrpmfpenfaeehlmlgidaleiirenk

Timeline for d1ybfc_:

• d1ybfc_ first appeared in SCOP 1.71
  
• d1ybfc_ appears in SCOPe 2.07