Lineage for d1ybfa_ (1ybf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2887922Protein AMP nucleosidase [110645] (2 species)
    contains extra N-terminal oligomerisation (sub)domain (8-153)
  7. 2887923Species Bacteroides thetaiotaomicron [TaxId:818] [117658] (1 PDB entry)
    Uniprot Q7MVU1
  8. 2887924Domain d1ybfa_: 1ybf A: [116609]
    Structural genomics target

Details for d1ybfa_

PDB Entry: 1ybf (more details), 2.9 Å

PDB Description: crystal structure of amp nucleosidase from bacteroides thetaiotaomicron vpi-5482
PDB Compounds: (A:) AMP nucleosidase

SCOPe Domain Sequences for d1ybfa_:

Sequence, based on SEQRES records: (download)

>d1ybfa_ c.56.2.1 (A:) AMP nucleosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
tkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnasaegv
tlinfgmgsanaatimdllwaihpkaviflgkcgglklenalgdyllpiaairgegtsnd
ylpeevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsthasgv
dmetatlmtvgfankipmgalllisdrpmfpegvkteesdqlvtdnfaeehlmlgidale
iirenk

Sequence, based on observed residues (ATOM records): (download)

>d1ybfa_ c.56.2.1 (A:) AMP nucleosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
tkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnasaegv
tlinfgmgsanaatimdllwaihpkaviflgkcgglklenalgdyllpiaairgegtsnd
ylpeevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsthasgv
dmetatlmtvgfankipmgalllisdrpmfpegvkteesnfaeehlmlgidaleiirenk

SCOPe Domain Coordinates for d1ybfa_:

Click to download the PDB-style file with coordinates for d1ybfa_.
(The format of our PDB-style files is described here.)

Timeline for d1ybfa_: