![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
![]() | Protein AMP nucleosidase [110645] (2 species) contains extra N-terminal oligomerisation (sub)domain (8-153) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [117658] (1 PDB entry) Uniprot Q7MVU1 |
![]() | Domain d1ybfa_: 1ybf A: [116609] Structural genomics target |
PDB Entry: 1ybf (more details), 2.9 Å
SCOPe Domain Sequences for d1ybfa_:
Sequence, based on SEQRES records: (download)
>d1ybfa_ c.56.2.1 (A:) AMP nucleosidase {Bacteroides thetaiotaomicron [TaxId: 818]} tkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnasaegv tlinfgmgsanaatimdllwaihpkaviflgkcgglklenalgdyllpiaairgegtsnd ylpeevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsthasgv dmetatlmtvgfankipmgalllisdrpmfpegvkteesdqlvtdnfaeehlmlgidale iirenk
>d1ybfa_ c.56.2.1 (A:) AMP nucleosidase {Bacteroides thetaiotaomicron [TaxId: 818]} tkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnasaegv tlinfgmgsanaatimdllwaihpkaviflgkcgglklenalgdyllpiaairgegtsnd ylpeevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsthasgv dmetatlmtvgfankipmgalllisdrpmfpegvkteesnfaeehlmlgidaleiirenk
Timeline for d1ybfa_: