Lineage for d1ybea1 (1ybe A:168-433)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 573722Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (2 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 573756Family c.1.17.2: Monomeric nicotinate phosphoribosyltransferase C-terminal domain-like [110910] (1 protein)
  6. 573757Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (2 species)
  7. 573758Species Agrobacterium tumefaciens [TaxId:358] [117391] (1 PDB entry)
  8. 573759Domain d1ybea1: 1ybe A:168-433 [116605]
    Other proteins in same PDB: d1ybea2, d1ybeb2

Details for d1ybea1

PDB Entry: 1ybe (more details), 2.5 Å

PDB Description: crystal structure of a nicotinate phosphoribosyltransferase

SCOP Domain Sequences for d1ybea1:

Sequence, based on SEQRES records: (download)

>d1ybea1 c.1.17.2 (A:168-433) Nicotinate phosphoribosyltransferase, C-terminal domain {Agrobacterium tumefaciens}
gyftldvlyarakakmwekverlrelpglrisdfgtrrrhsflwqrwcvealkegigpaf
tgtsnvllamdsdleavgtnahelpmvvaalaqtneelaaapyqvlkdwnrlyggnlliv
lpdafgtaaflrnapewvadwtgfrpdsappieggekiiewwrkmgrdprtkmlifsdgl
dvdaivdtyrhfegrvrmsfgwgtnltndfagcapktiaslkpisivckvsdangrpavk
lsdnpqkatgdpaeverylkffgeed

Sequence, based on observed residues (ATOM records): (download)

>d1ybea1 c.1.17.2 (A:168-433) Nicotinate phosphoribosyltransferase, C-terminal domain {Agrobacterium tumefaciens}
gyftldvlyarakakmwekverlrelpglrisdfgtrrrhsflwqrwcvealkegigpaf
tgtsnvllamdsdleavgtnahelpmvvaalaqtneelaaapyqvlkdwnrlyggnlliv
lpdafgtaaflrnapewvadwtgfrpdsappieggekiiewwrkmgrdprtkmlifsdgl
dvdaivdtyrhfegrvrmsfgwgtnltndfagcaplkpisivckvsdangrpavklsdnp
qkatgdpaeverylkffgeed

SCOP Domain Coordinates for d1ybea1:

Click to download the PDB-style file with coordinates for d1ybea1.
(The format of our PDB-style files is described here.)

Timeline for d1ybea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ybea2