Lineage for d1yb5b2 (1yb5 B:121-294)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841361Protein Quinone oxidoreductase [51747] (3 species)
  7. 2841365Species Human (Homo sapiens) [TaxId:9606] [117402] (1 PDB entry)
    Uniprot Q08257
  8. 2841367Domain d1yb5b2: 1yb5 B:121-294 [116604]
    Other proteins in same PDB: d1yb5a1, d1yb5b1
    Structural genomics target
    complexed with act, cl, gol, nap

Details for d1yb5b2

PDB Entry: 1yb5 (more details), 1.85 Å

PDB Description: Crystal structure of human Zeta-Crystallin with bound NADP
PDB Compounds: (B:) quinone oxidoreductase

SCOPe Domain Sequences for d1yb5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yb5b2 c.2.1.1 (B:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]}
ldfkqgaaigipyftayralihsacvkagesvlvhgasggvglaacqiarayglkilgta
gteegqkivlqngahevfnhrevnyidkikkyvgekgidiiiemlanvnlskdlsllshg
grvivvgsrgtieinprdtmakessiigvtlfsstkeefqqyaaalqagmeigw

SCOPe Domain Coordinates for d1yb5b2:

Click to download the PDB-style file with coordinates for d1yb5b2.
(The format of our PDB-style files is described here.)

Timeline for d1yb5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yb5b1