Lineage for d1yb5b1 (1yb5 B:6-120,B:295-329)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2394951Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2394952Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2395084Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2395429Protein Quinone oxidoreductase [50147] (3 species)
  7. 2395433Species Human (Homo sapiens) [TaxId:9606] [117168] (1 PDB entry)
    Uniprot Q08257
  8. 2395435Domain d1yb5b1: 1yb5 B:6-120,B:295-329 [116603]
    Other proteins in same PDB: d1yb5a2, d1yb5b2
    Structural genomics target
    complexed with act, cl, gol, nap

Details for d1yb5b1

PDB Entry: 1yb5 (more details), 1.85 Å

PDB Description: Crystal structure of human Zeta-Crystallin with bound NADP
PDB Compounds: (B:) quinone oxidoreductase

SCOPe Domain Sequences for d1yb5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yb5b1 b.35.1.2 (B:6-120,B:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]}
klmravrvfefggpevlklrsdiavpipkdhqvlikvhacgvnpvetyirsgtysrkpll
pytpgsdvagvieavgdnasafkkgdrvftsstisggyaeyalaadhtvyklpekXlkpv
igsqyplekvaeaheniihgsgatgkmilll

SCOPe Domain Coordinates for d1yb5b1:

Click to download the PDB-style file with coordinates for d1yb5b1.
(The format of our PDB-style files is described here.)

Timeline for d1yb5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yb5b2