![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
![]() | Protein Quinone oxidoreductase [51747] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117402] (1 PDB entry) Uniprot Q08257 |
![]() | Domain d1yb5a2: 1yb5 A:121-294 [116602] Other proteins in same PDB: d1yb5a1, d1yb5b1 Structural genomics target complexed with act, cl, gol, nap |
PDB Entry: 1yb5 (more details), 1.85 Å
SCOPe Domain Sequences for d1yb5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} ldfkqgaaigipyftayralihsacvkagesvlvhgasggvglaacqiarayglkilgta gteegqkivlqngahevfnhrevnyidkikkyvgekgidiiiemlanvnlskdlsllshg grvivvgsrgtieinprdtmakessiigvtlfsstkeefqqyaaalqagmeigw
Timeline for d1yb5a2: