Lineage for d1yb1a_ (1yb1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2090724Protein 17-beta-hydroxysteroid dehydrogenase type XI [117426] (1 species)
  7. 2090725Species Human (Homo sapiens) [TaxId:9606] [117427] (1 PDB entry)
    Uniprot Q8NBQ5 30-273
  8. 2090726Domain d1yb1a_: 1yb1 A: [116599]
    Structural genomics target
    complexed with aoi, cl, gol, so4

Details for d1yb1a_

PDB Entry: 1yb1 (more details), 1.95 Å

PDB Description: Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type XI
PDB Compounds: (A:) 17-beta-hydroxysteroid dehydrogenase type XI

SCOPe Domain Sequences for d1yb1a_:

Sequence, based on SEQRES records: (download)

>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]}
rrksvtgeivlitgaghgigrltayefaklksklvlwdinkhgleetaakckglgakvht
fvvdcsnrediyssakkvkaeigdvsilvnnagvvytsdlfatqdpqiektfevnvlahf
wttkaflpamtknnhghivtvasaaghvsvpfllaycsskfaavgfhktltdelaalqit
gvkttclcpnfvntgfiknpstslgptlepeevvnrlmhgilteqkmifipssiaflttl
eril

Sequence, based on observed residues (ATOM records): (download)

>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]}
rrksvtgeivlitgaghgigrltayefaklksklvlwdinkhgleetaakckglgakvht
fvvdcsnrediyssakkvkaeigdvsilvnnagvvytsdlfatqdpqiektfevnvlahf
wttkaflpamtknnhghivtvasaahvsvpfllaycsskfaavgfhktltdelaalqitg
vkttclcpnfvntgfiknpstslgptlepeevvnrlmhgilteqkmifipssiaflttle
ril

SCOPe Domain Coordinates for d1yb1a_:

Click to download the PDB-style file with coordinates for d1yb1a_.
(The format of our PDB-style files is described here.)

Timeline for d1yb1a_: