Lineage for d1yavb1 (1yav B:13-75)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721299Fold d.37: CBS-domain [54630] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721300Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 721301Family d.37.1.1: CBS-domain [54632] (10 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain
  6. 721344Protein Hypothetical protein YkuL [117881] (1 species)
  7. 721345Species Bacillus subtilis [TaxId:1423] [117882] (1 PDB entry)
  8. 721348Domain d1yavb1: 1yav B:13-75 [116597]

Details for d1yavb1

PDB Entry: 1yav (more details), 2.1 Å

PDB Description: crystal structure of cbs domain-containing protein ykul from bacillus subtilis
PDB Compounds: (B:) hypothetical protein BSU14130

SCOP Domain Sequences for d1yavb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yavb1 d.37.1.1 (B:13-75) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]}
eatvgqfmieadkvahvqvgnnlehallvltktgytaipvldpsyrlhgligtnmimnsi
fgl

SCOP Domain Coordinates for d1yavb1:

Click to download the PDB-style file with coordinates for d1yavb1.
(The format of our PDB-style files is described here.)

Timeline for d1yavb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yavb2