Lineage for d1y9ua_ (1y9u A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144460Protein Ferric-binding protein FbpA [53867] (7 species)
  7. 2144461Species Bordetella pertussis [TaxId:520] [117745] (1 PDB entry)
    Uniprot Q7VXW9 31-349
  8. 2144462Domain d1y9ua_: 1y9u A: [116594]

Details for d1y9ua_

PDB Entry: 1y9u (more details), 1.39 Å

PDB Description: Bordetella ferric binding protein
PDB Compounds: (A:) Putative iron binding protein

SCOPe Domain Sequences for d1y9ua_:

Sequence, based on SEQRES records: (download)

>d1y9ua_ c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella pertussis [TaxId: 520]}
devslyttrepkliqplldafakdsgikvntvfvkdgllervraegdkspadvlmtvdig
nlidlvnggvtqkiqsqtldsvvpanlrgaegswyalslrdrvlyvekdlkldsfrygdl
adpkwkgkvcirsgqhpyntalvaamiahdgaeatekwlrgvkanlarkaaggdrdvard
ilggicdiglanayyvghmknaepgtdarkwgdaikvvrptfatakdggthvnisgaava
ahapnkanavklleylvsepaqtlyaqanyeypvragvkldavvasfgplkvdtlpvaei
akyrkqaselvdkvgfdn

Sequence, based on observed residues (ATOM records): (download)

>d1y9ua_ c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella pertussis [TaxId: 520]}
devslyttrepkliqplldafakdsgikvntvfvkdgllervraegdkspadvlmtvdig
nlidlvnggvtqkiqsqtldsvvpanlrgaegswyalslrdrvlyvekdlkldsfrygdl
adpkwkgkvcirsgqhpyntalvaamiahdgaeatekwlrgvkanlarkaaggdrdvard
ilggicdiglanayyvghmknaepgtdarkwgdaikvvrptfaggthvnisgaavaahap
nkanavklleylvsepaqtlyaqanyeypvragvkldavvasfgplkvdtlpvaeiakyr
kqaselvdkvgfdn

SCOPe Domain Coordinates for d1y9ua_:

Click to download the PDB-style file with coordinates for d1y9ua_.
(The format of our PDB-style files is described here.)

Timeline for d1y9ua_: