Lineage for d1y9qa2 (1y9q A:83-181)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567256Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 567257Superfamily b.82.1: RmlC-like cupins [51182] (16 families) (S)
  5. 567514Family b.82.1.15: Probable transcriptional regulator VC1968, C-terminal domain [117315] (1 protein)
  6. 567515Protein Probable transcriptional regulator VC1968, C-terminal domain [117316] (1 species)
  7. 567516Species Vibrio cholerae [TaxId:666] [117317] (1 PDB entry)
  8. 567517Domain d1y9qa2: 1y9q A:83-181 [116593]
    Other proteins in same PDB: d1y9qa1
    Structural genomics target
    complexed with med, zn

Details for d1y9qa2

PDB Entry: 1y9q (more details), 1.9 Å

PDB Description: crystal structure of hth_3 family transcriptional regulator from vibrio cholerae

SCOP Domain Sequences for d1y9qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae}
sfpddlnmkihtlfpyaadtgleifeitlldhhqqmssphalgvieyihvlegimkvffd
eqwhelqqgehirffsdqphgyaavtekavfqnivaypr

SCOP Domain Coordinates for d1y9qa2:

Click to download the PDB-style file with coordinates for d1y9qa2.
(The format of our PDB-style files is described here.)

Timeline for d1y9qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y9qa1