SCOPe 2.08: Domain d1y9qa2: 1y9q A:83-181

Lineage for d1y9qa2 (1y9q A:83-181)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.15: Probable transcriptional regulator VC1968, C-terminal domain [117315] (1 protein)

6. Protein Probable transcriptional regulator VC1968, C-terminal domain [117316] (1 species)

7. Species Vibrio cholerae [TaxId:666] [117317] (1 PDB entry)
   Uniprot Q9KQN0

8. Domain d1y9qa2: 1y9q A:83-181 [116593]
   Other proteins in same PDB: d1y9qa1
   Structural genomics target
   complexed with med, zn

Details for d1y9qa2

PDB Entry: 1y9q, 1.9 Å

PDB Description: crystal structure of hth_3 family transcriptional regulator from vibrio cholerae

PDB Compounds: (A:) transcriptional regulator, HTH_3 family

SCOPe Domain Sequences for d1y9qa2:

Sequence; same for both SEQRES and ATOM records:

>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]}
sfpddlnmkihtlfpyaadtgleifeitlldhhqqmssphalgvieyihvlegimkvffd
eqwhelqqgehirffsdqphgyaavtekavfqnivaypr

Timeline for d1y9qa2:

• d1y9qa2 first appeared in SCOP 1.71
  
• d1y9qa2 appears in SCOPe 2.07