SCOPe 2.04: Domain d1y9qa1: 1y9q A:4-82

Lineage for d1y9qa1 (1y9q A:4-82)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.8: Probable transcriptional regulator VC1968, N-terminal domain [116898] (1 protein)

6. Protein Probable transcriptional regulator VC1968, N-terminal domain [116899] (1 species)

7. Species Vibrio cholerae [TaxId:666] [116900] (1 PDB entry)
   Uniprot Q9KQN0

8. Domain d1y9qa1: 1y9q A:4-82 [116592]
   Other proteins in same PDB: d1y9qa2
   structural genomics target
   complexed with med, zn

Details for d1y9qa1

PDB Entry: 1y9q, 1.9 Å

PDB Description: crystal structure of hth_3 family transcriptional regulator from vibrio cholerae

PDB Compounds: (A:) transcriptional regulator, HTH_3 family

SCOPe Domain Sequences for d1y9qa1:

Sequence; same for both SEQRES and ATOM records:

>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]}
tdvmfksqianqlknlrksrglsldataqltgvskamlgqiergessptiatlwkiasgl
easfsaffandpqllsser

Timeline for d1y9qa1:

• d1y9qa1 first appeared in SCOP 1.71
  
• d1y9qa1 appears in SCOPe 2.03
  
• d1y9qa1 appears in SCOPe 2.05
  
• d1y9qa1 appears in the current release, SCOPe 2.08