![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.8: Probable transcriptional regulator VC1968, N-terminal domain [116898] (1 protein) |
![]() | Protein Probable transcriptional regulator VC1968, N-terminal domain [116899] (1 species) |
![]() | Species Vibrio cholerae [TaxId:666] [116900] (1 PDB entry) Uniprot Q9KQN0 |
![]() | Domain d1y9qa1: 1y9q A:4-82 [116592] Other proteins in same PDB: d1y9qa2 structural genomics target complexed with med, zn |
PDB Entry: 1y9q (more details), 1.9 Å
SCOPe Domain Sequences for d1y9qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} tdvmfksqianqlknlrksrglsldataqltgvskamlgqiergessptiatlwkiasgl easfsaffandpqllsser
Timeline for d1y9qa1: