Lineage for d1y9qa1 (1y9q A:4-82)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709700Family a.35.1.8: Probable transcriptional regulator VC1968, N-terminal domain [116898] (1 protein)
  6. 2709701Protein Probable transcriptional regulator VC1968, N-terminal domain [116899] (1 species)
  7. 2709702Species Vibrio cholerae [TaxId:666] [116900] (1 PDB entry)
    Uniprot Q9KQN0
  8. 2709703Domain d1y9qa1: 1y9q A:4-82 [116592]
    Other proteins in same PDB: d1y9qa2
    structural genomics target
    complexed with med, zn

Details for d1y9qa1

PDB Entry: 1y9q (more details), 1.9 Å

PDB Description: crystal structure of hth_3 family transcriptional regulator from vibrio cholerae
PDB Compounds: (A:) transcriptional regulator, HTH_3 family

SCOPe Domain Sequences for d1y9qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]}
tdvmfksqianqlknlrksrglsldataqltgvskamlgqiergessptiatlwkiasgl
easfsaffandpqllsser

SCOPe Domain Coordinates for d1y9qa1:

Click to download the PDB-style file with coordinates for d1y9qa1.
(The format of our PDB-style files is described here.)

Timeline for d1y9qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y9qa2