Lineage for d1y9ma1 (1y9m A:373-536)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556764Family b.29.1.19: Glycosyl hydrolases family 32 C-terminal domain [101652] (2 proteins)
    Pfam 08244
    flat sheet beta-sandwich lacking the characteristic beta-bulge in the C-terminal strand
  6. 556773Protein Exo-inulinase [117137] (1 species)
  7. 556774Species Aspergillus awamori [TaxId:105351] [117138] (3 PDB entries)
  8. 556777Domain d1y9ma1: 1y9m A:373-536 [116590]
    Other proteins in same PDB: d1y9ma2
    complexed with gol, man, nag

Details for d1y9ma1

PDB Entry: 1y9m (more details), 1.89 Å

PDB Description: crystal structure of exo-inulinase from aspergillus awamori in spacegroup p212121

SCOP Domain Sequences for d1y9ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9ma1 b.29.1.19 (A:373-536) Exo-inulinase {Aspergillus awamori}
eawssisnkrpiysrtfktlsegstnttttgetfkvdlsfsakskastfaialrasanft
eqtlvgydfakqqifldrthsgdvsfdetfasvyhgpltpdstgvvklsifvdrssvevf
ggqgettltaqifpssdavharlastggttedvradiykiastw

SCOP Domain Coordinates for d1y9ma1:

Click to download the PDB-style file with coordinates for d1y9ma1.
(The format of our PDB-style files is described here.)

Timeline for d1y9ma1:

Domains from same chain:
(mouse over for more information)
d1y9ma2