SCOPe 2.06: Domain d1y9ia_: 1y9i A:

Lineage for d1y9ia_ (1y9i A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.195: YutG-like [101306] (1 superfamily)
   core: 6 helices; bundle; one central helix is surrounded by 5 others

4. Superfamily a.195.1: YutG-like [101307] (1 family)

5. Family a.195.1.1: YutG-like [101308] (3 proteins)
   Pfam PF01892; DUF64

6. Protein Low temperature requirement C protein, LtrC [116955] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [116956] (1 PDB entry)
   Uniprot Q9ZIM5

8. Domain d1y9ia_: 1y9i A: [116586]
   Structural genomics target
   complexed with ca, gol, mg

Details for d1y9ia_

PDB Entry: 1y9i, 1.8 Å

PDB Description: crystal structure of low temperature requirement c protein from listeria monocytogenes

PDB Compounds: (A:) low temperature requirement C protein

SCOPe Domain Sequences for d1y9ia_:

Sequence; same for both SEQRES and ATOM records:

>d1y9ia_ a.195.1.1 (A:) Low temperature requirement C protein, LtrC {Listeria monocytogenes [TaxId: 1639]}
kqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkrevqnav
ltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyidkvkp
gilaklnehdgiavhtflddivgaiaaaaasrlahsyhd

Timeline for d1y9ia_:

• d1y9ia_ first appeared in SCOP 1.71
  
• d1y9ia_ appears in SCOPe 2.05
  
• d1y9ia_ appears in SCOPe 2.07
  
• d1y9ia_ appears in the current release, SCOPe 2.08