Class a: All alpha proteins [46456] (289 folds) |
Fold a.195: YutG-like [101306] (1 superfamily) core: 6 helices; bundle; one central helix is surrounded by 5 others |
Superfamily a.195.1: YutG-like [101307] (1 family) |
Family a.195.1.1: YutG-like [101308] (3 proteins) Pfam PF01892; DUF64 |
Protein Low temperature requirement C protein, LtrC [116955] (1 species) |
Species Listeria monocytogenes [TaxId:1639] [116956] (1 PDB entry) Uniprot Q9ZIM5 |
Domain d1y9ia_: 1y9i A: [116586] Structural genomics target complexed with ca, gol, mg |
PDB Entry: 1y9i (more details), 1.8 Å
SCOPe Domain Sequences for d1y9ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y9ia_ a.195.1.1 (A:) Low temperature requirement C protein, LtrC {Listeria monocytogenes [TaxId: 1639]} kqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkrevqnav ltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyidkvkp gilaklnehdgiavhtflddivgaiaaaaasrlahsyhd
Timeline for d1y9ia_: