Lineage for d1y9ga2 (1y9g A:20-372)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674809Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 674815Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families) (S)
  5. 674873Family b.67.2.3: Glycosyl hydrolases family 32 N-terminal domain [101884] (2 proteins)
    Pfam PF00251; Glycosyl hydrolase family 32
  6. 674888Protein Exo-inulinase [117272] (1 species)
  7. 674889Species Aspergillus awamori [TaxId:105351] [117273] (3 PDB entries)
  8. 674891Domain d1y9ga2: 1y9g A:20-372 [116585]
    Other proteins in same PDB: d1y9ga1
    complexed with fru, nag

Details for d1y9ga2

PDB Entry: 1y9g (more details), 1.87 Å

PDB Description: crystal structure of exo-inulinase from aspergillus awamori complexed with fructose
PDB Compounds: (A:) exo-inulinase

SCOP Domain Sequences for d1y9ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9ga2 b.67.2.3 (A:20-372) Exo-inulinase {Aspergillus awamori [TaxId: 105351]}
fnydqpyrgqyhfspqknwmndpngllyhngtyhlffqynpggiewgniswghaisedlt
hweekpvallargfgsdvtemyfsgsavadvnntsgfgkdgktplvamytsyypvaqtlp
sgqtvqedqqsqsiayslddgltwttydaanpvipnppspyeaeyqnfrdpfvfwhdesq
kwvvvtsiaelhklaiytsdnlkdwklvsefgpynaqggvwecpglvklpldsgnstkwv
itsglnpggppgtvgsgtqyfvgefdgttftpdadtvypgnstanwmdwgpdfyaaagyn
glslndhvhigwmnnwqyganiptypwrsamaiprhmalktigskatlvqqpq

SCOP Domain Coordinates for d1y9ga2:

Click to download the PDB-style file with coordinates for d1y9ga2.
(The format of our PDB-style files is described here.)

Timeline for d1y9ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y9ga1