![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.19: Glycosyl hydrolases family 32 C-terminal domain [101652] (2 proteins) Pfam PF08244 flat sheet beta-sandwich lacking the characteristic beta-bulge in the C-terminal strand |
![]() | Protein Exo-inulinase [117137] (1 species) |
![]() | Species Aspergillus awamori [TaxId:105351] [117138] (3 PDB entries) Uniprot Q96TU3 20-536 |
![]() | Domain d1y9ga1: 1y9g A:373-536 [116584] Other proteins in same PDB: d1y9ga2 complexed with fru, nag |
PDB Entry: 1y9g (more details), 1.87 Å
SCOPe Domain Sequences for d1y9ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y9ga1 b.29.1.19 (A:373-536) Exo-inulinase {Aspergillus awamori [TaxId: 105351]} eawssisnkrpiysrtfktlsegstnttttgetfkvdlsfsakskastfaialrasanft eqtlvgydfakqqifldrthsgdvsfdetfasvyhgpltpdstgvvklsifvdrssvevf ggqgettltaqifpssdavharlastggttedvradiykiastw
Timeline for d1y9ga1: