Lineage for d1y9ed2 (1y9e D:128-294)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841314Protein Hypothetical protein YhfP [117405] (1 species)
  7. 2841315Species Bacillus subtilis [TaxId:1423] [117406] (2 PDB entries)
    Uniprot O07615
  8. 2841325Domain d1y9ed2: 1y9e D:128-294 [116579]
    Other proteins in same PDB: d1y9ea1, d1y9eb1, d1y9ec1, d1y9ed1, d1y9ee1, d1y9ef1
    complexed with nad

Details for d1y9ed2

PDB Entry: 1y9e (more details), 2.8 Å

PDB Description: crystal structure of bacillus subtilis protein yhfp with nad bound
PDB Compounds: (D:) hypothetical protein yhfP

SCOPe Domain Sequences for d1y9ed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9ed2 c.2.1.1 (D:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]}
ygtagftaalsvhrleqnglspekgsvlvtgatggvggiavsmlnkrgydvvastgnrea
adylkqlgasevisredvydgtlkalskqqwqgavdpvggkqlasllskiqyggsvavsg
ltgggevpatvypfilrgvsllgidsvycpmdvraavwermssdlkp

SCOPe Domain Coordinates for d1y9ed2:

Click to download the PDB-style file with coordinates for d1y9ed2.
(The format of our PDB-style files is described here.)

Timeline for d1y9ed2: