SCOPe 2.08: Domain d1y9ed1: 1y9e D:2-127,D:295-330

Lineage for d1y9ed1 (1y9e D:2-127,D:295-330)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Hypothetical protein YhfP [117171] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [117172] (2 PDB entries)
   Uniprot O07615

8. Domain d1y9ed1: 1y9e D:2-127,D:295-330 [116578]
   Other proteins in same PDB: d1y9ea2, d1y9eb2, d1y9ec2, d1y9ed2, d1y9ee2, d1y9ef2
   complexed with nad

Details for d1y9ed1

PDB Entry: 1y9e, 2.8 Å

PDB Description: crystal structure of bacillus subtilis protein yhfp with nad bound

PDB Compounds: (D:) hypothetical protein yhfP

SCOPe Domain Sequences for d1y9ed1:

Sequence; same for both SEQRES and ATOM records:

>d1y9ed1 b.35.1.2 (D:2-127,D:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]}
stlfqalqaeknaddvsvhvktistedlpkdgvlikvaysginykdglagkaggnivrey
plilgidaagtvvssndprfaegdeviatsyelgvsrdgglseyasvpgdwlvplpqnls
lkeamvXdqlltivdrevsleetpgalkdilqnriqgrvivkl

Timeline for d1y9ed1:

• d1y9ed1 first appeared in SCOP 1.71
  
• d1y9ed1 appears in SCOPe 2.07