Lineage for d1y9ed1 (1y9e D:2-127,D:295-330)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. Protein Hypothetical protein YhfP [117171] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [117172] (2 PDB entries)
    Uniprot O07615
  8. Domain d1y9ed1: 1y9e D:2-127,D:295-330 [116578]
    Other proteins in same PDB: d1y9ea2, d1y9eb2, d1y9ec2, d1y9ed2, d1y9ee2, d1y9ef2
    complexed with nad

Details for d1y9ed1

PDB Entry: 1y9e (more details), 2.8 Å

PDB Description: crystal structure of bacillus subtilis protein yhfp with nad bound
PDB Compounds: (D:) hypothetical protein yhfP

SCOPe Domain Sequences for d1y9ed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9ed1 b.35.1.2 (D:2-127,D:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]}
stlfqalqaeknaddvsvhvktistedlpkdgvlikvaysginykdglagkaggnivrey
plilgidaagtvvssndprfaegdeviatsyelgvsrdgglseyasvpgdwlvplpqnls
lkeamvXdqlltivdrevsleetpgalkdilqnriqgrvivkl

SCOPe Domain Coordinates for d1y9ed1 are not available.

Timeline for d1y9ed1:

Domains from same chain:
(mouse over for more information)
d1y9ed2
Domains from other chains:
(mouse over for more information)
d1y9ea1, d1y9ea2, d1y9eb1, d1y9eb2, d1y9ec1, d1y9ec2, d1y9ee1, d1y9ee2, d1y9ef1, d1y9ef2