Class b: All beta proteins [48724] (176 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) |
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
Protein Hypothetical protein YhfP [117171] (1 species) |
Species Bacillus subtilis [TaxId:1423] [117172] (2 PDB entries) Uniprot O07615 |
Domain d1y9ec1: 1y9e C:2-127,C:295-330 [116576] Other proteins in same PDB: d1y9ea2, d1y9eb2, d1y9ec2, d1y9ed2, d1y9ee2, d1y9ef2 complexed with nad |
PDB Entry: 1y9e (more details), 2.8 Å
SCOPe Domain Sequences for d1y9ec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y9ec1 b.35.1.2 (C:2-127,C:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} stlfqalqaeknaddvsvhvktistedlpkdgvlikvaysginykdglagkaggnivrey plilgidaagtvvssndprfaegdeviatsyelgvsrdgglseyasvpgdwlvplpqnls lkeamvXdqlltivdrevsleetpgalkdilqnriqgrvivkl
Timeline for d1y9ec1: