![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
![]() | Protein Hypothetical protein YhfP [117405] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [117406] (2 PDB entries) Uniprot O07615 |
![]() | Domain d1y9eb2: 1y9e B:128-294 [116575] Other proteins in same PDB: d1y9ea1, d1y9eb1, d1y9ec1, d1y9ed1, d1y9ee1, d1y9ef1 complexed with nad |
PDB Entry: 1y9e (more details), 2.8 Å
SCOPe Domain Sequences for d1y9eb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y9eb2 c.2.1.1 (B:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} ygtagftaalsvhrleqnglspekgsvlvtgatggvggiavsmlnkrgydvvastgnrea adylkqlgasevisredvydgtlkalskqqwqgavdpvggkqlasllskiqyggsvavsg ltgggevpatvypfilrgvsllgidsvycpmdvraavwermssdlkp
Timeline for d1y9eb2: