SCOP 1.71: Domain d1y9ea2: 1y9e A:128-294

Lineage for d1y9ea2 (1y9e A:128-294)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
   N-terminal all-beta domain defines family

6. Protein Hypothetical protein YhfP [117405] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [117406] (2 PDB entries)

8. Domain d1y9ea2: 1y9e A:128-294 [116573]
   Other proteins in same PDB: d1y9ea1, d1y9eb1, d1y9ec1, d1y9ed1, d1y9ee1, d1y9ef1

Details for d1y9ea2

PDB Entry: 1y9e, 2.8 Å

PDB Description: crystal structure of bacillus subtilis protein yhfp with nad bound

SCOP Domain Sequences for d1y9ea2:

Sequence; same for both SEQRES and ATOM records:

>d1y9ea2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis}
ygtagftaalsvhrleqnglspekgsvlvtgatggvggiavsmlnkrgydvvastgnrea
adylkqlgasevisredvydgtlkalskqqwqgavdpvggkqlasllskiqyggsvavsg
ltgggevpatvypfilrgvsllgidsvycpmdvraavwermssdlkp

Timeline for d1y9ea2:

• d1y9ea2 is new in SCOP 1.71
  
• d1y9ea2 appears in SCOP 1.73
  
• d1y9ea2 appears in the current release, SCOPe 2.08