Lineage for d1y9ea1 (1y9e A:2-127,A:295-330)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666133Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 666134Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 666255Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 666510Protein Hypothetical protein YhfP [117171] (1 species)
  7. 666511Species Bacillus subtilis [TaxId:1423] [117172] (2 PDB entries)
  8. 666518Domain d1y9ea1: 1y9e A:2-127,A:295-330 [116572]
    Other proteins in same PDB: d1y9ea2, d1y9eb2, d1y9ec2, d1y9ed2, d1y9ee2, d1y9ef2

Details for d1y9ea1

PDB Entry: 1y9e (more details), 2.8 Å

PDB Description: crystal structure of bacillus subtilis protein yhfp with nad bound
PDB Compounds: (A:) hypothetical protein yhfP

SCOP Domain Sequences for d1y9ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9ea1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]}
stlfqalqaeknaddvsvhvktistedlpkdgvlikvaysginykdglagkaggnivrey
plilgidaagtvvssndprfaegdeviatsyelgvsrdgglseyasvpgdwlvplpqnls
lkeamvXdqlltivdrevsleetpgalkdilqnriqgrvivkl

SCOP Domain Coordinates for d1y9ea1:

Click to download the PDB-style file with coordinates for d1y9ea1.
(The format of our PDB-style files is described here.)

Timeline for d1y9ea1: