Lineage for d1y92b_ (1y92 B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597438Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 597439Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulfide-rich
  5. 597440Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 597671Protein Seminal ribonucleasease [54086] (1 species)
  7. 597672Species Cow (Bos taurus) [TaxId:9913] [54087] (12 PDB entries)
  8. 597686Domain d1y92b_: 1y92 B: [116569]
    mutant

Details for d1y92b_

PDB Entry: 1y92 (more details), 2.2 Å

PDB Description: crystal structure of the p19a/n67d variant of bovine seminal ribonuclease

SCOP Domain Sequences for d1y92b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y92b_ d.5.1.1 (B:) Seminal ribonucleasease {Cow (Bos taurus)}
kesaaakferqhmdsgnsassssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

SCOP Domain Coordinates for d1y92b_:

Click to download the PDB-style file with coordinates for d1y92b_.
(The format of our PDB-style files is described here.)

Timeline for d1y92b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y92a_