Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.43: CAC2371-like [117688] (3 proteins) similar overall fold to the Glycine N-methyltransferase (53348) and mRNA cap (Guanine N-7) methyltransferase (102560) families |
Protein Putative methyltransferase CAC2371 [117689] (1 species) |
Species Clostridium acetobutylicum [TaxId:1488] [117690] (1 PDB entry) Uniprot Q97GJ5 |
Domain d1y8ca_: 1y8c A: [116563] Structural genomics target complexed with so4 |
PDB Entry: 1y8c (more details), 2.5 Å
SCOPe Domain Sequences for d1y8ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} ncynkfahiydkliradvdykkwsdfiiekcvennlvfddyldlacgtgnltenlcpkfk ntwavdlsqemlseaenkfrsqglkprlacqdisnlninrkfdlitccldstnyiidsdd lkkyfkavsnhlkeggvfifdinsyyklsqvlgnndfnydddevfyywenqfeddlvsmy isffvrdgefykrfdeeheeraykeediekylkhgqlnildkvdcysnkkvekfterity lvklgg
Timeline for d1y8ca_: