Lineage for d1y8ba_ (1y8b A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 573353Superfamily c.1.13: Malate synthase G [51645] (1 family) (S)
  5. 573354Family c.1.13.1: Malate synthase G [51646] (1 protein)
  6. 573355Protein Malate synthase G [51647] (2 species)
    contains the insert of all-beta (sub)domain and the C-terminal extension of all-alpha (sub)domain
  7. 573356Species Escherichia coli [TaxId:562] [51648] (3 PDB entries)
  8. 573360Domain d1y8ba_: 1y8b A: [116562]
    mutant

Details for d1y8ba_

PDB Entry: 1y8b (more details)

PDB Description: solution nmr-derived global fold of malate synthase g from e.coli

SCOP Domain Sequences for d1y8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8ba_ c.1.13.1 (A:) Malate synthase G {Escherichia coli}
maqtitqsrlridanfkrfvdeevlpgtgldaaafwrnfdeivhdlapenrqllaerdri
qaaldewhrsnpgpvkdkaayksflrelgylvpqpervtvettgidseitsqagpqlvvp
amnaryalnaanarwgslydalygsdiipqegamvsgydpqrgeqviawvrrfldeslpl
engsyqdvvafkvvdkqlriqlkngkettlrtpaqfvgyrgdaaaptcillknnglhiel
qidangrigkddpahindviveaaistildcedsvaavdaedkillyrnllglmqgtlqe
kmekngrqivrklnddrhytaadgseislhgrsllfirnvghlmtipviwdsegneipeg
ildgvmtgaialydlkvqknsrtgsvyivkpkmhgpqevafanklftrietmlgmapntl
kmgimdeerrtslnlrsciaqarnrvafintgfldrtgdemhsvmeagpmlrknqmkstp
wikayernnvlsglfcglrgkaqigkgmwampdlmadmysqkgdqlragantawvpspta
atlhalhyhqtnvqsvqaniaqtefnaefepllddlltipvaenanwsaqeiqqeldnnv
qgilgyvvrwveqgigcskvpdihnvalmedratlrissqhianwlrhgiltkeqvqasl
enmakvvdqqnagdpayrpmagnfanscafkaasdliflgvkqpngytepllhawrlrek
esh

SCOP Domain Coordinates for d1y8ba_:

Click to download the PDB-style file with coordinates for d1y8ba_.
(The format of our PDB-style files is described here.)

Timeline for d1y8ba_: