Lineage for d1y83b_ (1y83 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531063Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 531125Species Human (Homo sapiens) [TaxId:9606] [46501] (159 PDB entries)
  8. 531266Domain d1y83b_: 1y83 B: [116553]
    Other proteins in same PDB: d1y83a_, d1y83c_

Details for d1y83b_

PDB Entry: 1y83 (more details), 1.9 Å

PDB Description: t-to-t(high) quaternary transitions in human hemoglobin: betay145g deoxy low-salt (1 test set)

SCOP Domain Sequences for d1y83b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y83b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkgh

SCOP Domain Coordinates for d1y83b_:

Click to download the PDB-style file with coordinates for d1y83b_.
(The format of our PDB-style files is described here.)

Timeline for d1y83b_: