Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (26 species) |
Species Human (Homo sapiens) [TaxId:9606] [46501] (289 PDB entries) Uniprot P68871 |
Domain d1y83b_: 1y83 B: [116553] Other proteins in same PDB: d1y83a_, d1y83c_ complexed with hem |
PDB Entry: 1y83 (more details), 1.9 Å
SCOPe Domain Sequences for d1y83b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y83b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkgh
Timeline for d1y83b_: